FLUORESCEIN DPc10 INACTIVE PEPTIDE

FLUORESCEIN DPc10 INACTIVE PEPTIDE

£138.83

Product code: A010-517
Unit size: 200µg net peptide

no

 
Description
An inactive fluorescein labelled form of DPc10 differing in sequence at one position from the CPVT mimetic peptide DPc10. Serves as a negative control for DPc10 (A010-514).
Chemistry
Synthetic peptide, sequence 5Flu-GFCPDHKAAMVLFLDSVYGIEVQDFLLHLLEVGFLP, derived from a CPVT-mutant form of RYR2 (residues (Gly2460-Pro2495, rabbit). Inactive derivative of DPc10. Formula weight 4393.046: 5-Carboxyfluorescein at N-terminus, free C-terminus, trifluoroacetate counter ions.
Purity
95% pure (HPLC reverse phase C18 column 100A 4.6 x 150mm column, gradient from 10% – 90% acetonitrile, in 15 minutes. 60 degC). Yellow powdered solid.
Quantity
200 μg net peptide weight
Solubility
Soluble in dimethylsulphoxide
Storage
Store as supplied at -20°C for up to 1 year. Store desiccated. Make fresh solutions prior to use.
Regulatory statement
Product for research use only. Not intended for diagnostic or therapeutic use.
Template is not defined.