DPc10 Peptide

DPc10 Peptide

£121.47

Product code: A010-514
Unit size: 200µg net peptide

yes

 
Description
DPc10 peptide is a 36-residue peptide corresponding to the Gly2460-Pro2495 region of rabbit RyR2. It interacts with RyR2 and provokes abnormal channel activity usually seen in mutant RYR2 channels associated with CPVT.
Chemistry
Synthetic peptide, sequence GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP, derived from RYR2 (residues (Gly2460-Pro2495, rabbit). Formula weight 4103.835: Free N-terminus, free C-terminus, trifluoroacetate counter ions.
Purity
95% pure (HPLC reverse phase C18 column 100A 4.6 x 150mm column, gradient from 10% – 90% acetonitrile, in 15 minutes. 60 degC). Off white powdered solid.
Quantity
200 μg net peptide weight
Solubility
Soluble in dimethylsulphoxide
Storage
Store as supplied at -20°C for up to 1 year. Store desiccated. Make fresh solutions prior to use.
Regulatory statement
Product for research use only. Not intended for diagnostic or therapeutic use.
Template is not defined.