DPc10 Peptides Sampler Pack

DPc10 Peptides Sampler Pack

$525.00

Product code: A010-518
Unit size: 4 x 200µg units

no

 
Description
Multiple DPc10 bioactive peptide sampler pack containing 200ug each of DPc10 Peptide (Cat. A010-514); DPc10 Inactive Peptide (Cat. A010-515); Fluorescein DPc10 Peptide (Cat. A010-516); Fluorescein DPc10 Inactive Peptide (Cat. A010-517)
Chemistry
Four related synthetic peptides related to DPc10 (sequence GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP; residues (Gly2460-Pro2495, rabbit). DPc10, fluorescein-DPc10, inactive-DPc10, fluorescein-Inactive-DPc10. Formula weight Shown on the datasheet (in region of 4100): Free N-terminus, free C-terminus, trifluoroacetate counter ions.
Purity
95% pure (HPLC reverse phase C18 column 100A 4.6 x 150mm column, gradient from 10% – 90% acetonitrile, in 15 minutes. 60 degC). Off white powdered solid.
Quantity
200 μg net peptide weight
Solubility
Soluble in dimethylsulphoxide
Storage
Store as supplied at -20°C for up to 1 year. Store desiccated. Make fresh solutions prior to use.
Regulatory statement
Product for research use only. Not intended for diagnostic or therapeutic use.
Template is not defined.